Project name: 31eba664b96bb38

Status: done

submitted: 2026-01-14 04:47:29, status changed: 2026-01-14 06:48:32

Project settings
Protein sequence(s) MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence RVIVQVFGSNCR
Simulation mc cycles50
Peptide secondary structure psipred CCEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 53.6343 1.51023 16.5675 81
cluster_2.pdb ( medoid) 18.8827 6.40798 21.0452 121
cluster_3.pdb ( medoid) 18.162 10.7367 24.3461 195
cluster_4.pdb ( medoid) 14.7418 10.3786 26.5887 153
cluster_5.pdb ( medoid) 10.6477 4.60194 19.0871 49
cluster_6.pdb ( medoid) 10.5865 6.99006 21.7314 74
cluster_7.pdb ( medoid) 9.52067 12.9193 28.7161 123
cluster_8.pdb ( medoid) 8.65094 7.39804 30.3066 64
cluster_9.pdb ( medoid) 6.19196 13.0815 27.7463 81
cluster_10.pdb ( medoid) 4.32477 13.6423 29.4839 59