CABS-dock: 251229 IgV_Only

Project name: 251229 IgV_Only_7

Status: done

submitted: 2025-12-29 08:39:36, status changed: 2025-12-29 11:45:03

Project settings

Protein sequence(s)	AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence	WHRSYYTWNLNT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.1385	4.07381	29.7148	135
cluster_2.pdb ( medoid)	30.1395	5.50771	14.3847	166
cluster_3.pdb ( medoid)	16.8614	9.19261	33.8029	155
cluster_4.pdb ( medoid)	13.4	7.01491	27.7814	94
cluster_5.pdb ( medoid)	9.27195	12.6187	30.4363	117
cluster_6.pdb ( medoid)	8.31934	8.05352	24.4439	67
cluster_7.pdb ( medoid)	8.19307	10.8628	26.3795	89
cluster_8.pdb ( medoid)	7.92447	8.20244	20.3703	65
cluster_9.pdb ( medoid)	6.56509	9.59622	24.6644	63
cluster_10.pdb ( medoid)	6.31156	7.76353	24.2603	49