CABS-dock: 32614b05eab91b3

Project name: 32614b05eab91b3

Status: done

submitted: 2026-01-21 15:00:58, status changed: 2026-01-21 20:55:16

Project settings

Protein sequence(s)	EASRQQQRRFNTSSIRDFEFWLSEAETLLAMKDQQARDLASSAGNLLKKHQLLERREMLAREDALKDLNTLAEDDLLSSSGTTFNVDQIVKKKDNNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEHWEEKLKELAKARGLKLEESLEYLQFMQ input pdb
Peptide sequence	VPSENDGTFTSNLTGHTKKT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.6632	5.37186	20.9163	111
cluster_2.pdb ( medoid)	19.5309	4.45447	14.2206	87
cluster_3.pdb ( medoid)	16.6929	8.56652	39.5356	143
cluster_4.pdb ( medoid)	10.297	9.12889	36.0969	94
cluster_5.pdb ( medoid)	9.48049	11.1809	32.4404	106
cluster_6.pdb ( medoid)	8.86188	10.2687	39.6957	91
cluster_7.pdb ( medoid)	6.96977	14.9216	44.8783	104
cluster_8.pdb ( medoid)	4.42357	15.1461	54.7276	67
cluster_9.pdb ( medoid)	3.67416	26.9449	56.2742	99
cluster_10.pdb ( medoid)	2.98534	16.0785	45.0688	48