CABS-dock: 32de827ed017a46

Project name: 32de827ed017a46

Status: done

submitted: 2026-04-02 12:36:33, status changed: 2026-04-02 14:46:42

Project settings

Protein sequence(s)	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence	LEEFLERWELLREWA
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	49.3571	2.06657	23.0841	102
cluster_2.pdb ( medoid)	42.274	2.38917	15.7317	101
cluster_3.pdb ( medoid)	18.8866	3.86517	15.4462	73
cluster_4.pdb ( medoid)	16.3685	10.3247	35.7628	169
cluster_5.pdb ( medoid)	13.29	3.38601	14.3376	45
cluster_6.pdb ( medoid)	12.7141	9.04506	38.0645	115
cluster_7.pdb ( medoid)	12.0123	8.99079	28.1265	108
cluster_8.pdb ( medoid)	11.5267	7.98148	22.9459	92
cluster_9.pdb ( medoid)	9.22767	16.0387	38.2017	148
cluster_10.pdb ( medoid)	5.77512	8.13836	28.1055	47