CABS-dock: 32e4cd9a0905ad8

Project name: 32e4cd9a0905ad8

Status: done

submitted: 2026-01-22 13:40:58, status changed: 2026-01-22 16:02:03

Project settings

Protein sequence(s)	GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWQEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE input pdb
Peptide sequence	IQETYSEESCSTVTRGYKSV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCHHHCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.2474	4.1987	16.7633	127
cluster_2.pdb ( medoid)	26.5364	3.69304	17.7909	98
cluster_3.pdb ( medoid)	17.8251	11.5568	36.2814	206
cluster_4.pdb ( medoid)	14.4934	8.62461	35.2424	125
cluster_5.pdb ( medoid)	10.1013	10.6917	38.4588	108
cluster_6.pdb ( medoid)	8.59633	10.3532	28.6167	89
cluster_7.pdb ( medoid)	6.3293	13.5876	34.4273	86
cluster_8.pdb ( medoid)	4.8196	18.2588	33.7683	88
cluster_9.pdb ( medoid)	3.17493	16.0633	32.259	51
cluster_10.pdb ( medoid)	2.30006	9.56499	22.3065	22