CABS-dock: primed p24

Project name: primed p24

Status: done

submitted: 2025-05-09 14:47:54, status changed: 2025-05-09 19:47:33

Project settings

Protein sequence(s)	TPIATFVSGSPSLNTYNATTVNSSANAFSCAYYLQQWNIQGLLVTSLYLKLDSATMGNRPGDLNSANAKWFTFWVSAYLQQCNPSGIQAGTVSPSTATLTDFEPMANRSVTSPWTYSANGYYEPSIGEFQVFSPVVTGAWNPGNIGIRVLPVPVSASGERYTLLCYSLQCTNASIFNPNNSGTMIVGPVLYSCPAASLP input pdb
Peptide sequence	MQKADM
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	74.2449	1.45465	5.58658	108
cluster_2.pdb ( medoid)	41.4496	2.87096	20.662	119
cluster_3.pdb ( medoid)	34.8963	3.18085	15.3167	111
cluster_4.pdb ( medoid)	30.1747	4.2751	17.9161	129
cluster_5.pdb ( medoid)	13.1167	8.84369	31.8433	116
cluster_6.pdb ( medoid)	10.4812	12.117	35.2557	127
cluster_7.pdb ( medoid)	9.95184	13.5653	33.1759	135
cluster_8.pdb ( medoid)	6.87627	7.99852	17.7365	55
cluster_9.pdb ( medoid)	5.1414	13.226	37.5646	68
cluster_10.pdb ( medoid)	2.5006	12.7969	26.3673	32