Project name: A-4j8s

Status: done

submitted: 2026-01-12 17:43:57, status changed: 2026-01-12 20:34:36

Project settings
Protein sequence(s) QQTDLSQVWPEANQHFSKEIDDEANSYFQRIYNHPPHHPTMSVDEVLEMLQRFKDSTIKREREVFNCMLRNLFEEYRFFPQYPDKELHITACLFGGIIEKGLVTYMALGLALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASSISHFMQFPHHLQQEYIEYGQQSRDPPVK input pdb
Peptide sequence SIKEPQSRLRKWTTVDSIS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCHHHHCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 55.3721 4.6052 13.2672 255
cluster_2.pdb ( medoid) 19.1607 5.47997 22.1948 105
cluster_3.pdb ( medoid) 17.2172 9.99002 31.7452 172
cluster_4.pdb ( medoid) 14.4849 6.21338 21.2706 90
cluster_5.pdb ( medoid) 8.51667 8.68884 22.1432 74
cluster_6.pdb ( medoid) 7.83092 8.68353 25.9006 68
cluster_7.pdb ( medoid) 5.75702 12.6802 33.2575 73
cluster_8.pdb ( medoid) 4.95797 14.9255 30.5039 74
cluster_9.pdb ( medoid) 4.77736 15.9084 36.6297 76
cluster_10.pdb ( medoid) 1.58927 8.17986 14.8175 13