CABS-dock: 341c1724464cc0a

Project name: 341c1724464cc0a

Status: done

submitted: 2026-01-16 18:04:20, status changed: 2026-01-17 03:22:05

Project settings

Protein sequence(s)	QIIIISPPPSSTPPPTNATPPPTNATPPPTSTTPPSTNTTTPTNTISKAANITKPGCPKQCGNLTVPYPFGIGLQSGCAIDPTFEINCVTNATGSQTPVIGNIQVYDISDAEMRISNTLNRRCYSSTGLLLQDDPAWMNLGSLNPYSCDEAAVIAGRDFANCCPTVCMSSSQVIEGRCMGAGCCQIPIPKGIKFFNTSMQSSKLNHTAVWSFNRCGYAFLGEASRFEFMGLQDLGDLILYNVPIVVDWAIGNLSCKRNDYACLDNSWCVDSDTGIGGYRCNCISGYKGNPYIGLGCQDPNANSCEQICINTPGSYNCSCPQGYTGDGRKNGRGCNAPSSNSEFPWIK input pdb
Peptide sequence	TIDNVHAQNVGEDLITVKGEGGAAV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	16.9202	6.61932	41.2081	112
cluster_2.pdb ( medoid)	14.5294	7.9838	31.3443	116
cluster_3.pdb ( medoid)	11.3746	10.1102	37.1581	115
cluster_4.pdb ( medoid)	11.0072	11.447	25.5127	126
cluster_5.pdb ( medoid)	10.7887	10.2886	31.3236	111
cluster_6.pdb ( medoid)	9.82455	7.73572	17.0739	76
cluster_7.pdb ( medoid)	7.49635	10.9387	42.9402	82
cluster_8.pdb ( medoid)	5.54439	12.8057	36.9779	71
cluster_9.pdb ( medoid)	3.06403	7.18007	13.6474	22
cluster_10.pdb ( medoid)	2.40457	28.6954	65.5336	69