CABS-dock: 347fbd6c6845c47

Project name: 347fbd6c6845c47

Status: done

submitted: 2026-06-23 11:07:46, status changed: 2026-06-23 13:40:44

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	HRHRHVQLFGYRHRHRH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.1827	10.0057	33.66	302
cluster_2.pdb ( medoid)	21.8019	5.82518	24.17	127
cluster_3.pdb ( medoid)	15.7381	5.21029	18.9693	82
cluster_4.pdb ( medoid)	15.673	6.31659	17.0482	99
cluster_5.pdb ( medoid)	8.30281	8.67177	30.1594	72
cluster_6.pdb ( medoid)	7.46208	11.927	34.444	89
cluster_7.pdb ( medoid)	4.48225	13.8324	33.0631	62
cluster_8.pdb ( medoid)	3.72567	17.9833	33.0218	67
cluster_9.pdb ( medoid)	3.47946	15.8071	28.5475	55
cluster_10.pdb ( medoid)	2.21172	20.3462	43.7201	45