CABS-dock: DRAMP00409M

Project name: DRAMP00409M

Status: done

submitted: 2024-07-25 15:28:30, status changed: 2024-07-25 21:44:11

Project settings

Protein sequence(s)

SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMVLPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ input pdb

Peptide sequence

KTCENLADTY

Simulation mc cycles

Peptide secondary structure psipred

CCCHHHHCCC

Contact information

163:A 1:PEP 5.0 1.0

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	43.3407	4.33772	13.8975	188
cluster_2.pdb ( medoid)	26.2948	6.69333	28.0657	176
cluster_3.pdb ( medoid)	21.4402	5.4104	31.1508	116
cluster_4.pdb ( medoid)	20.2032	3.01932	12.218	61
cluster_5.pdb ( medoid)	19.4544	3.75236	24.9407	73
cluster_6.pdb ( medoid)	12.7459	6.355	30.7961	81
cluster_7.pdb ( medoid)	12.5738	6.99868	20.176	88
cluster_8.pdb ( medoid)	11.8572	5.56625	15.9779	66
cluster_9.pdb ( medoid)	9.94249	7.54338	15.3025	75
cluster_10.pdb ( medoid)	8.69553	8.74012	20.9655	76