Project name: 34e93adfc7b2941

Status: done

submitted: 2026-01-21 14:58:59, status changed: 2026-01-22 01:41:10

Project settings
Protein sequence(s) VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence VPSENDGTFTSNLTGHTKKT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCEECCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.6935 5.05161 22.9232 150
cluster_2.pdb ( medoid) 21.2855 7.46987 41.1025 159
cluster_3.pdb ( medoid) 18.212 3.23963 10.3851 59
cluster_4.pdb ( medoid) 14.1161 6.16319 34.5185 87
cluster_5.pdb ( medoid) 13.6766 9.87088 28.7975 135
cluster_6.pdb ( medoid) 10.3438 9.76433 36.4337 101
cluster_7.pdb ( medoid) 9.90113 15.2508 46.9579 151
cluster_8.pdb ( medoid) 7.96802 9.41263 27.118 75
cluster_9.pdb ( medoid) 3.5707 16.5234 37.4603 59
cluster_10.pdb ( medoid) 1.82411 13.1571 39.9308 24