CABS-dock: 365692796e2417e

Project name: 365692796e2417e

Status: done

submitted: 2026-02-26 17:23:55, status changed: 2026-02-27 00:34:23

Project settings

Protein sequence(s)	MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK input pdb
Peptide sequence	KQWLALEWKQ
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEECEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	31.6995	3.88019	18.6975	123
cluster_2.pdb ( medoid)	26.6862	4.0845	12.6878	109
cluster_3.pdb ( medoid)	25.779	4.22824	13.7975	109
cluster_4.pdb ( medoid)	24.7947	3.58948	21.0527	89
cluster_5.pdb ( medoid)	18.0654	6.31042	14.3919	114
cluster_6.pdb ( medoid)	11.3992	5.26353	10.9891	60
cluster_7.pdb ( medoid)	10.9195	6.6853	14.2266	73
cluster_8.pdb ( medoid)	9.90495	5.14894	9.248	51
cluster_9.pdb ( medoid)	9.01622	12.7548	29.7481	115
cluster_10.pdb ( medoid)	8.90345	6.40201	12.7553	57