Project name: NanAlast

Status: done

submitted: 2026-05-01 08:19:39, status changed: 2026-05-01 21:26:59

Project settings
Protein sequence(s) GAALTEKTDIFESGRNGKPNKDGIKSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTITNLRDNPKASDPSIGSPVNIDMVLVQDPETKRIFSIYDMFPEGKGIFGMSSQKEEAYKKIDGKTYQILYREGEKGAYTIRENGTVYTPDGKATDYRVVVDPVKPAYSDKGDLYKGNQLLGNIYFTTNKTSPFRIAKDSYLWMSYSDDDGKTWSAPQDITPMVKADWMKFLGVGPGTGIVLRNGPHKGRILIPVYTTNNVSHLNGSQSSRIIYSDDHGKTWHAGEAVNDNRQVDGQKIHSSTMNNRRAQNTESTVVQLNNGDVKLFMRGLTGDLQVATSKDGGVTWEKDIKRYPQVKDVYVQMSAIHTMHEGKEYIILSNAGGPKRENGMVHLARVEENGELTWLKHNPIQKGEFAYNSLQELGNGEYGILYEHTEKGQNAYTLSFRKFNWDFLSKDL input pdb
Peptide sequence HQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEEEECCCCHHHEEEEEECCEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 50.5985 1.97634 4.56794 100
cluster_2.pdb ( medoid) 40.9154 2.49295 25.1079 102
cluster_3.pdb ( medoid) 35.6205 2.80737 8.08963 100
cluster_4.pdb ( medoid) 11.2567 8.88363 20.9858 100
cluster_5.pdb ( medoid) 10.6733 10.1187 32.3204 108
cluster_6.pdb ( medoid) 8.3823 20.0422 64.0648 168
cluster_7.pdb ( medoid) 6.6003 18.787 47.0022 124
cluster_8.pdb ( medoid) 5.43313 14.1723 41.133 77
cluster_9.pdb ( medoid) 4.03085 19.8469 50.4507 80
cluster_10.pdb ( medoid) 2.29176 17.8902 44.168 41