Project name: rd_cabs_1EB9_blinding

Status: done

submitted: 2026-07-10 15:47:20, status changed: 2026-07-10 17:24:11

Project settings
Protein sequence(s) FLGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVNSSGRIVTN input pdb
Peptide sequence KQTSV
Simulation mc cycles50
Peptide secondary structure psipred CCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 40.238 2.9077 22.2865 117
cluster_2.pdb ( medoid) 31.5875 4.74871 23.5833 150
cluster_3.pdb ( medoid) 27.1972 5.07405 22.1824 138
cluster_4.pdb ( medoid) 26.6045 4.43533 12.328 118
cluster_5.pdb ( medoid) 18.347 6.32256 24.9641 116
cluster_6.pdb ( medoid) 11.7935 6.27466 29.8879 74
cluster_7.pdb ( medoid) 11.7291 9.88994 34.3089 116
cluster_8.pdb ( medoid) 7.43107 5.11367 14.5373 38
cluster_9.pdb ( medoid) 6.11383 9.81381 29.5185 60
cluster_10.pdb ( medoid) 5.87311 12.4295 36.7163 73