CABS-dock: 2UV0_First

Project name: 2UV0_First_sequence

Status: done

submitted: 2026-04-19 12:54:52, status changed: 2026-04-19 13:37:46

Project settings

Protein sequence(s)	DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENAEANRFMESVLPTLWMLKDYALQSGAGLAFE input pdb
Peptide sequence	AWKEKIRKKLKNEIKKKGRKAVIAW
Simulation mc cycles	5
Peptide secondary structure psipred	CHHHHHHHHHHHHHHHHCCCHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	172.612	0.579335	2.06197	100
cluster_2.pdb ( medoid)	35.0741	2.8226	21.385	99
cluster_3.pdb ( medoid)	16.4892	7.52007	27.6426	124
cluster_4.pdb ( medoid)	14.3172	7.82275	32.692	112
cluster_5.pdb ( medoid)	13.3359	8.92331	15.2662	119
cluster_6.pdb ( medoid)	9.90934	10.7979	29.5464	107
cluster_7.pdb ( medoid)	8.69967	13.1039	26.2763	114
cluster_8.pdb ( medoid)	7.68132	13.0186	30.5892	100
cluster_9.pdb ( medoid)	6.27003	9.72882	33.6341	61
cluster_10.pdb ( medoid)	4.72444	13.5466	31.1645	64