CABS-dock: JG38675.T1+P04295|

Project name: JG38675.T1+P04295|

Status: done

submitted: 2026-02-27 10:23:15, status changed: 2026-02-27 18:30:55

Project settings

Protein sequence(s)	PVLTKSAGERFLLYRPSTTTNSGLMAPDLYVYVDPAFTANTRASGTGVAVVGRYRDDYIIFALEHFFLRALTGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEMHRLLASEGADAGSGPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTETVSPNTDGASDDLMVAVIMAIYLAAQAGPPHTF input pdb
Peptide sequence	KNKTKKGKLIQIIVNKSRGSVP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCEEEEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.4476	7.36268	32.3024	180
cluster_2.pdb ( medoid)	22.6437	5.52029	35.4877	125
cluster_3.pdb ( medoid)	20.5231	3.84931	12.2834	79
cluster_4.pdb ( medoid)	11.3253	9.00639	27.5368	102
cluster_5.pdb ( medoid)	10.4051	4.99754	23.6941	52
cluster_6.pdb ( medoid)	7.90125	13.1625	34.4001	104
cluster_7.pdb ( medoid)	7.17015	10.3206	20.5098	74
cluster_8.pdb ( medoid)	7.03558	16.2034	44.6693	114
cluster_9.pdb ( medoid)	6.6007	17.7254	43.9369	117
cluster_10.pdb ( medoid)	1.68723	31.4124	53.552	53