Project name: JG38675.T1+P04295|

Status: done

submitted: 2026-02-27 10:23:15, status changed: 2026-02-27 18:30:55

Project settings
Protein sequence(s) PVLTKSAGERFLLYRPSTTTNSGLMAPDLYVYVDPAFTANTRASGTGVAVVGRYRDDYIIFALEHFFLRALTGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEMHRLLASEGADAGSGPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTETVSPNTDGASDDLMVAVIMAIYLAAQAGPPHTF input pdb
Peptide sequence KNKTKKGKLIQIIVNKSRGSVP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCEEEEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.4476 7.36268 32.3024 180
cluster_2.pdb ( medoid) 22.6437 5.52029 35.4877 125
cluster_3.pdb ( medoid) 20.5231 3.84931 12.2834 79
cluster_4.pdb ( medoid) 11.3253 9.00639 27.5368 102
cluster_5.pdb ( medoid) 10.4051 4.99754 23.6941 52
cluster_6.pdb ( medoid) 7.90125 13.1625 34.4001 104
cluster_7.pdb ( medoid) 7.17015 10.3206 20.5098 74
cluster_8.pdb ( medoid) 7.03558 16.2034 44.6693 114
cluster_9.pdb ( medoid) 6.6007 17.7254 43.9369 117
cluster_10.pdb ( medoid) 1.68723 31.4124 53.552 53