Project name: D3DN36_UPPS

Status: done

submitted: 2026-06-12 15:59:18, status changed: 2026-06-12 20:25:57

Project settings
Protein sequence(s) KLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE input pdb
Peptide sequence QNPFPK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 46.7876 1.60299 5.01887 75
cluster_2.pdb ( medoid) 43.6059 1.81168 28.4399 79
cluster_3.pdb ( medoid) 38.9677 4.13162 29.3466 161
cluster_4.pdb ( medoid) 37.5526 5.13945 23.5537 193
cluster_5.pdb ( medoid) 24.2892 7.12251 26.4776 173
cluster_6.pdb ( medoid) 12.6058 3.25247 23.1787 41
cluster_7.pdb ( medoid) 7.33026 9.00378 29.1316 66
cluster_8.pdb ( medoid) 6.67301 16.1846 36.3031 108
cluster_9.pdb ( medoid) 4.51524 13.5098 41.8107 61
cluster_10.pdb ( medoid) 4.28748 10.0292 30.2311 43