Project name: MUTATED 1545

Status: done

submitted: 2026-04-20 15:51:24, status changed: 2026-04-20 22:47:13

Project settings
Protein sequence(s) MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIMALTIMGVIFLISIIVLVCSCDKNNDQYKFHKLLP input pdb
Peptide sequence SSLITSLGAILSCYGKT
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHHHHHHHCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.1551 8.36262 32.9604 202
cluster_2.pdb ( medoid) 19.0696 5.82079 24.9344 111
cluster_3.pdb ( medoid) 17.1822 8.20616 35.6992 141
cluster_4.pdb ( medoid) 14.6241 9.09459 34.2984 133
cluster_5.pdb ( medoid) 8.72663 14.4386 33.6362 126
cluster_6.pdb ( medoid) 5.26018 11.9768 30.7249 63
cluster_7.pdb ( medoid) 4.97886 11.8501 30.0352 59
cluster_8.pdb ( medoid) 3.81935 17.2804 39.2547 66
cluster_9.pdb ( medoid) 3.67141 15.5254 34.5112 57
cluster_10.pdb ( medoid) 2.99173 14.0387 28.5183 42