CABS-dock: MUTATED 1545

Project name: MUTATED 1545

Status: done

submitted: 2026-04-20 15:51:24, status changed: 2026-04-20 22:47:13

Project settings

Protein sequence(s)	MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIMALTIMGVIFLISIIVLVCSCDKNNDQYKFHKLLP input pdb
Peptide sequence	SSLITSLGAILSCYGKT
Simulation mc cycles	50
Peptide secondary structure psipred	CCHHHHHHHHHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.1551	8.36262	32.9604	202
cluster_2.pdb ( medoid)	19.0696	5.82079	24.9344	111
cluster_3.pdb ( medoid)	17.1822	8.20616	35.6992	141
cluster_4.pdb ( medoid)	14.6241	9.09459	34.2984	133
cluster_5.pdb ( medoid)	8.72663	14.4386	33.6362	126
cluster_6.pdb ( medoid)	5.26018	11.9768	30.7249	63
cluster_7.pdb ( medoid)	4.97886	11.8501	30.0352	59
cluster_8.pdb ( medoid)	3.81935	17.2804	39.2547	66
cluster_9.pdb ( medoid)	3.67141	15.5254	34.5112	57
cluster_10.pdb ( medoid)	2.99173	14.0387	28.5183	42