CABS-dock: 38a6b0993d0ad53

Project name: 38a6b0993d0ad53

Status: done

submitted: 2026-01-22 13:05:55, status changed: 2026-01-22 14:43:24

Project settings

Protein sequence(s)	GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence	ATFDKNDEDSPIVMHQEDGST
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.2481	6.49515	33.6223	151
cluster_2.pdb ( medoid)	19.7994	8.28309	36.1709	164
cluster_3.pdb ( medoid)	13.9385	7.46133	31.0866	104
cluster_4.pdb ( medoid)	12.5595	11.0673	35.3841	139
cluster_5.pdb ( medoid)	12.1342	13.0211	40.5263	158
cluster_6.pdb ( medoid)	9.28021	7.65069	24.8962	71
cluster_7.pdb ( medoid)	6.77603	4.57495	17.2198	31
cluster_8.pdb ( medoid)	6.65048	10.9766	25.458	73
cluster_9.pdb ( medoid)	5.39784	7.41038	27.1445	40
cluster_10.pdb ( medoid)	4.6082	14.9733	32.9701	69