CABS-dock: 2O2F-PGPMGPRGPA

Project name: 2O2F-PGPMGPRGPA

Status: done

submitted: 2025-08-24 08:58:42, status changed: 2025-08-24 11:11:06

Project settings

Protein sequence(s)	GYDNREIVMKYIHYKLSQRGYEWDEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP input pdb
Peptide sequence	PGPMGPRGPA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	32.103	3.36417	20.2472	108
cluster_2.pdb ( medoid)	18.6718	7.17659	30.9152	134
cluster_3.pdb ( medoid)	16.2664	13.2789	37.9629	216
cluster_4.pdb ( medoid)	13.4557	12.857	30.303	173
cluster_5.pdb ( medoid)	11.1271	8.62761	22.5874	96
cluster_6.pdb ( medoid)	4.79731	16.8844	36.946	81
cluster_7.pdb ( medoid)	4.63309	15.5404	33.1675	72
cluster_8.pdb ( medoid)	3.76407	13.2835	25.7043	50
cluster_9.pdb ( medoid)	3.41776	14.0443	26.2519	48
cluster_10.pdb ( medoid)	1.12958	19.4763	36.6649	22