CABS-dock: 3955b97fcdee87

Project name: 3955b97fcdee87

Status: done

submitted: 2026-07-15 00:22:05, status changed: 2026-07-15 08:04:45

Project settings

Protein sequence(s)	QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQQLVHVVKWAKALPGFRNLHVDDQMMAVIQYSSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMMYSSQCVRMRHLSQEFGWLQITPQEFLCCMKALLLLFSIIPVDGLKNNQKKFFDELLRMNYIKELDRIIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMMVVSVDFPEMMAEIISVQVPKKILSGKVKPIYFHTQ input pdb
Peptide sequence	FVSLFTWMLKALTRV
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	53.4805	2.39339	14.097	128
cluster_2.pdb ( medoid)	43.0674	2.48448	13.6716	107
cluster_3.pdb ( medoid)	26.3284	3.83617	15.0591	101
cluster_4.pdb ( medoid)	24.6286	3.08584	14.6968	76
cluster_5.pdb ( medoid)	22.1778	8.52204	26.8717	189
cluster_6.pdb ( medoid)	14.8653	7.46704	22.9255	111
cluster_7.pdb ( medoid)	14.8576	9.96125	38.9128	148
cluster_8.pdb ( medoid)	10.4168	9.31184	27.469	97
cluster_9.pdb ( medoid)	1.98606	12.0842	22.4358	24
cluster_10.pdb ( medoid)	1.59402	11.9196	21.161	19