CABS-dock: 395691a1ae2cac2

Project name: 395691a1ae2cac2

Status: done

submitted: 2025-04-22 12:20:08, status changed: 2025-04-22 15:56:27

Project settings

Protein sequence(s)	QPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK input pdb
Peptide sequence	SDPDTYNRSTSSTIY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	65.202	1.16561	18.29	76
cluster_2.pdb ( medoid)	36.2166	3.23056	16.5875	117
cluster_3.pdb ( medoid)	22.9491	8.75853	29.0978	201
cluster_4.pdb ( medoid)	20.4904	8.44298	21.2333	173
cluster_5.pdb ( medoid)	20.4184	3.82009	15.7432	78
cluster_6.pdb ( medoid)	14.8652	8.13984	20.8833	121
cluster_7.pdb ( medoid)	13.5152	5.25335	13.9552	71
cluster_8.pdb ( medoid)	6.13894	13.5202	28.6038	83
cluster_9.pdb ( medoid)	4.53109	6.17952	26.8934	28
cluster_10.pdb ( medoid)	3.75738	13.8394	25.9664	52