Project name: 39baf97fc0e1645

Status: done

submitted: 2026-04-05 05:27:39, status changed: 2026-04-05 08:59:13

Project settings
Protein sequence(s) KDVFGTSVYGQTVILTVSTSLSPRSEMRADDKFVNVTIVTILAETTSDNEKTVTEKINKAIRSSSSNFLNYDLTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDC input pdb
Peptide sequence TSLSPRSEMRADDKFVNVTIVTILAETTSD
Simulation mc cycles50
Peptide secondary structure psipred CCCCCHHHHCCCCCCEEEEEEEEEEEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 36.254 2.75831 6.10769 100
cluster_2.pdb ( medoid) 30.8657 7.28964 25.2117 225
cluster_3.pdb ( medoid) 21.5078 5.2539 32.3361 113
cluster_4.pdb ( medoid) 17.2036 7.32406 32.7996 126
cluster_5.pdb ( medoid) 6.85598 13.7107 39.0827 94
cluster_6.pdb ( medoid) 5.6848 10.7304 30.4772 61
cluster_7.pdb ( medoid) 5.42176 10.8821 31.5294 59
cluster_8.pdb ( medoid) 4.94076 17.4062 40.5841 86
cluster_9.pdb ( medoid) 4.34056 16.8181 35.0168 73
cluster_10.pdb ( medoid) 2.98523 21.1039 43.5322 63