CABS-dock: 39e776f63dd95be

Project name: 39e776f63dd95be

Status: done

submitted: 2026-04-02 12:35:33, status changed: 2026-04-02 14:37:54

Project settings

Protein sequence(s)	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence	TTDHISAAGPW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	16.1603	8.53942	39.5208	138
cluster_2.pdb ( medoid)	16.0206	10.9859	36.5656	176
cluster_3.pdb ( medoid)	12.011	10.6569	35.8511	128
cluster_4.pdb ( medoid)	9.35839	12.7159	48.3259	119
cluster_5.pdb ( medoid)	8.39672	11.433	31.8198	96
cluster_6.pdb ( medoid)	8.00016	12.4998	41.503	100
cluster_7.pdb ( medoid)	6.40726	11.7055	32.508	75
cluster_8.pdb ( medoid)	4.14105	14.4891	46.5881	60
cluster_9.pdb ( medoid)	3.63927	17.0364	38.138	62
cluster_10.pdb ( medoid)	2.32865	19.7539	36.4969	46