Project name: 9ASF_HKSAIV_E2

Status: done

submitted: 2026-05-30 16:28:39, status changed: 2026-05-31 10:06:16

Project settings
Protein sequence(s) GSSHSMRYFFTSVSRPGRGEPRFIAVVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSSQQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW input pdb
Peptide sequence HKSAIVTLTYDSEWQRDQ
Simulation mc cycles200
Peptide secondary structure psipred CCCEEEEEECCCCHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 58.5454 1.70808 5.84935 100
cluster_2.pdb ( medoid) 40.7793 4.31591 12.4009 176
cluster_3.pdb ( medoid) 21.0558 6.41152 18.449 135
cluster_4.pdb ( medoid) 20.8984 8.85234 20.261 185
cluster_5.pdb ( medoid) 13.7966 7.75551 20.277 107
cluster_6.pdb ( medoid) 10.8986 4.40422 16.4911 48
cluster_7.pdb ( medoid) 10.872 5.4268 10.2679 59
cluster_8.pdb ( medoid) 8.33162 8.7618 22.9648 73
cluster_9.pdb ( medoid) 8.0671 6.81782 17.6358 55
cluster_10.pdb ( medoid) 6.83895 9.06572 24.7127 62