CABS-dock: 3a24280e954806d

Project name: 3a24280e954806d

Status: done

submitted: 2026-01-01 03:40:29, status changed: 2026-01-01 13:49:11

Project settings

Protein sequence(s)	LLDSFAVDHTRMQAPAVRTAKTMNTPHGDAITVFDLRFCIPNKEVMPEKGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMADVLKVQDQNQIPELNVYQCGTYQMHSLSEAQDIARHILERDVRVNSNKELALPKEKLQELLLDSFAVDHTRMQAPAVRTAKTMNTPHGDAITVFDLRFCIPNKEVMPEKGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMADVLKVQDQNQIPELNVYQCGTYQMHSLSEAQDIARHILERDVRVNSNKELALPKEKLQELHILEH input pdb
Peptide sequence	TDRLKGKVALVTGGTLGLG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCEEEEECCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.5081	4.03517	33.8019	111
cluster_2.pdb ( medoid)	16.7392	8.36361	33.1676	140
cluster_3.pdb ( medoid)	16.0003	10.3123	29.9607	165
cluster_4.pdb ( medoid)	14.0043	7.7119	22.4969	108
cluster_5.pdb ( medoid)	12.1047	5.61765	17.2926	68
cluster_6.pdb ( medoid)	11.3738	7.73707	32.8585	88
cluster_7.pdb ( medoid)	9.37836	5.9712	20.4	56
cluster_8.pdb ( medoid)	9.17167	12.5386	33.9446	115
cluster_9.pdb ( medoid)	8.10297	11.4773	24.7965	93
cluster_10.pdb ( medoid)	3.58578	15.6173	34.1798	56