Project name: 260628_LepB_3A_1

Status: done

submitted: 2026-06-28 04:10:41, status changed: 2026-06-28 08:15:57

Project settings
Protein sequence(s) RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDGLRLSRIGGIH input pdb
Peptide sequence MLSFAADAAA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.2557 4.58834 40.946 148
cluster_2.pdb ( medoid) 27.8427 3.87893 13.7241 108
cluster_3.pdb ( medoid) 16.183 9.08358 40.9978 147
cluster_4.pdb ( medoid) 12.3243 14.1185 52.1847 174
cluster_5.pdb ( medoid) 8.71953 14.3356 35.1984 125
cluster_6.pdb ( medoid) 6.7118 11.0254 33.3118 74
cluster_7.pdb ( medoid) 4.96431 15.9136 38.1435 79
cluster_8.pdb ( medoid) 4.7027 10.4195 33.4624 49
cluster_9.pdb ( medoid) 4.29166 13.9806 36.7452 60
cluster_10.pdb ( medoid) 2.33243 15.4346 38.3945 36