CABS-dock: 3a9923a6ba6df1f

Project name: 3a9923a6ba6df1f

Status: done

submitted: 2026-01-22 13:16:41, status changed: 2026-01-22 15:33:58

Project settings

Protein sequence(s)	GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence	RTAPKRGTVSEEKKHF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.3684	6.50386	23.8989	178
cluster_2.pdb ( medoid)	25.7835	5.70133	35.3329	147
cluster_3.pdb ( medoid)	17.0031	6.64586	27.2171	113
cluster_4.pdb ( medoid)	14.4436	6.57731	21.9588	95
cluster_5.pdb ( medoid)	12.6226	8.15999	20.4819	103
cluster_6.pdb ( medoid)	12.6179	8.71774	15.427	110
cluster_7.pdb ( medoid)	12.2019	8.19542	20.7558	100
cluster_8.pdb ( medoid)	7.89485	7.97989	20.4006	63
cluster_9.pdb ( medoid)	5.81505	11.8658	22.2015	69
cluster_10.pdb ( medoid)	1.92575	11.4241	21.6713	22