Project name: 3bc5def45453c7

Status: done

submitted: 2026-03-13 11:33:25, status changed: 2026-03-13 18:14:42

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RRRWKKVQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCCEEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.2778 5.40471 34.0144 115
cluster_2.pdb ( medoid) 16.545 8.28043 39.3631 137
cluster_3.pdb ( medoid) 15.0449 9.3055 32.8004 140
cluster_4.pdb ( medoid) 14.4551 7.8173 31.6075 113
cluster_5.pdb ( medoid) 10.3358 9.38489 26.5153 97
cluster_6.pdb ( medoid) 7.10591 12.5248 29.8489 89
cluster_7.pdb ( medoid) 5.65685 15.2028 37.6215 86
cluster_8.pdb ( medoid) 5.41408 15.6998 40.7708 85
cluster_9.pdb ( medoid) 4.56751 16.6393 40.0534 76
cluster_10.pdb ( medoid) 4.08534 15.1762 46.0186 62