CABS-dock: 3bfc187caa283e9

Project name: 3bfc187caa283e9

Status: done

submitted: 2026-01-13 14:48:44, status changed: 2026-01-13 18:46:02

Project settings

Protein sequence(s)	MGSGPIDPKELLKGLDSFLTRDGEVKSVDGIAKIFSLMKEARKMVSRCTYLNIILQTRAPEVLVKFIDVGGYKLLNSWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQLSKSSEDEELRKLASVLVSDWMAVIRSQS input pdb
Peptide sequence	VDSVQPYFYCDEEENFYQ
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	56.2151	2.0635	14.5073	116
cluster_2.pdb ( medoid)	42.1763	3.03488	14.9014	128
cluster_3.pdb ( medoid)	25.2511	3.40579	17.4416	86
cluster_4.pdb ( medoid)	22.859	9.66795	29.7298	221
cluster_5.pdb ( medoid)	14.7435	10.1739	25.835	150
cluster_6.pdb ( medoid)	13.2343	9.67184	32.2114	128
cluster_7.pdb ( medoid)	7.11848	3.51199	11.7548	25
cluster_8.pdb ( medoid)	6.64562	5.11615	11.1267	34
cluster_9.pdb ( medoid)	4.631	15.3315	34.9813	71
cluster_10.pdb ( medoid)	4.48847	9.13452	23.291	41