Project name: 3c3332643d6c74c

Status: done

submitted: 2026-03-09 15:27:07, status changed: 2026-03-09 19:07:23

Project settings
Protein sequence(s) GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK input pdb
Peptide sequence IKLSPETKDNL
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.3959 4.77767 26.3199 107
cluster_2.pdb ( medoid) 20.2118 6.97613 31.7236 141
cluster_3.pdb ( medoid) 18.82 6.32307 29.5693 119
cluster_4.pdb ( medoid) 18.8179 8.66196 27.8941 163
cluster_5.pdb ( medoid) 12.5506 8.76453 24.0877 110
cluster_6.pdb ( medoid) 10.5235 9.59759 28.3056 101
cluster_7.pdb ( medoid) 10.4357 7.95345 16.3706 83
cluster_8.pdb ( medoid) 7.6394 9.55573 26.5536 73
cluster_9.pdb ( medoid) 7.48552 9.48498 19.0335 71
cluster_10.pdb ( medoid) 2.18001 14.6789 27.8348 32