CABS-dock: 3cdb704c3d2b974

Project name: 3cdb704c3d2b974

Status: done

submitted: 2026-04-12 09:04:45, status changed: 2026-04-12 11:07:20

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRRVQLFGSNDARHR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.0406	7.30021	28.1873	139
cluster_2.pdb ( medoid)	17.4882	9.37775	28.4264	164
cluster_3.pdb ( medoid)	14.3634	9.74702	29.0535	140
cluster_4.pdb ( medoid)	8.60788	9.29381	25.7703	80
cluster_5.pdb ( medoid)	7.94149	12.5921	27.5196	100
cluster_6.pdb ( medoid)	7.13308	12.1967	30.8103	87
cluster_7.pdb ( medoid)	6.10952	14.4038	28.7466	88
cluster_8.pdb ( medoid)	5.98814	12.8588	25.5033	77
cluster_9.pdb ( medoid)	5.44471	14.3258	31.951	78
cluster_10.pdb ( medoid)	4.21258	11.157	27.0243	47