CABS-dock: 3d2424df5f618df

Project name: 3d2424df5f618df

Status: done

submitted: 2025-12-30 15:24:06, status changed: 2025-12-30 17:54:03

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	RVIVQCGSNSFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	69.3553	1.15348	5.5477	80
cluster_2.pdb ( medoid)	49.0628	4.28023	22.9158	210
cluster_3.pdb ( medoid)	24.7258	4.73191	18.8943	117
cluster_4.pdb ( medoid)	24.354	3.98291	22.2273	97
cluster_5.pdb ( medoid)	12.8862	5.12177	18.9262	66
cluster_6.pdb ( medoid)	12.1154	14.7746	31.8282	179
cluster_7.pdb ( medoid)	12.1036	7.84891	22.2148	95
cluster_8.pdb ( medoid)	11.8147	6.43269	19.4783	76
cluster_9.pdb ( medoid)	5.45062	9.90712	21.3728	54
cluster_10.pdb ( medoid)	1.84955	14.0575	26.7586	26