Project name: 251125 PD_CL2_6

Status: done

submitted: 2025-11-25 02:12:05, status changed: 2025-11-25 06:48:45

Project settings
Protein sequence(s) AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPEL input pdb
Peptide sequence WHRSYYTWNLNT
Simulation mc cycles50
Peptide secondary structure psipred CCCCEECEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 35.4164 5.47769 17.7277 194
cluster_2.pdb ( medoid) 21.7862 11.7506 35.1835 256
cluster_3.pdb ( medoid) 18.3771 7.45494 28.3397 137
cluster_4.pdb ( medoid) 10.054 8.95167 19.0537 90
cluster_5.pdb ( medoid) 9.02116 6.20762 27.1221 56
cluster_6.pdb ( medoid) 6.8654 11.07 31.0834 76
cluster_7.pdb ( medoid) 6.44371 12.4152 36.844 80
cluster_8.pdb ( medoid) 5.96057 5.36862 15.2414 32
cluster_9.pdb ( medoid) 4.45801 8.74829 27.7519 39
cluster_10.pdb ( medoid) 3.23215 12.3757 27.6912 40