Project name: seymahoca_6yce_sch_to_cys__a_zincir_apelin13

Status: done

submitted: 2026-02-13 18:11:01, status changed: 2026-02-14 18:00:00

Project settings
Protein sequence(s) VPQSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASAGAIYPYKAAKGTCKTNDGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSNGKKYWIVKNSWGARWGEAGYIRMARDVSSSSGICGIAIDPSLYPTLE input pdb
Peptide sequence QRPRLSHKGPMPF
Simulation mc cycles200
Peptide secondary structure CCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.8655 4.21621 15.9808 147
cluster_2.pdb ( medoid) 26.5646 5.68426 25.8292 151
cluster_3.pdb ( medoid) 26.4186 4.88292 27.5611 129
cluster_4.pdb ( medoid) 25.0414 3.43431 15.5442 86
cluster_5.pdb ( medoid) 15.3756 8.06473 22.3103 124
cluster_6.pdb ( medoid) 8.95503 13.0653 32.4257 117
cluster_7.pdb ( medoid) 6.71492 14.4454 41.0599 97
cluster_8.pdb ( medoid) 5.7523 11.6475 35.5139 67
cluster_9.pdb ( medoid) 3.29585 14.2603 32.4038 47
cluster_10.pdb ( medoid) 2.51901 13.8943 24.2171 35