CABS-dock: seymahoca_6yce_sch_to_cys__a_zincir

Project name: seymahoca_6yce_sch_to_cys__a_zincir_apelin13

Status: done

submitted: 2026-02-13 18:11:01, status changed: 2026-02-14 18:00:00

Project settings

Protein sequence(s)	VPQSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASAGAIYPYKAAKGTCKTNDGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSNGKKYWIVKNSWGARWGEAGYIRMARDVSSSSGICGIAIDPSLYPTLE input pdb
Peptide sequence	QRPRLSHKGPMPF
Simulation mc cycles	200
Peptide secondary structure	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	34.8655	4.21621	15.9808	147
cluster_2.pdb ( medoid)	26.5646	5.68426	25.8292	151
cluster_3.pdb ( medoid)	26.4186	4.88292	27.5611	129
cluster_4.pdb ( medoid)	25.0414	3.43431	15.5442	86
cluster_5.pdb ( medoid)	15.3756	8.06473	22.3103	124
cluster_6.pdb ( medoid)	8.95503	13.0653	32.4257	117
cluster_7.pdb ( medoid)	6.71492	14.4454	41.0599	97
cluster_8.pdb ( medoid)	5.7523	11.6475	35.5139	67
cluster_9.pdb ( medoid)	3.29585	14.2603	32.4038	47
cluster_10.pdb ( medoid)	2.51901	13.8943	24.2171	35