CABS-dock: 3de5da13f6c3a86

Project name: 3de5da13f6c3a86

Status: done

submitted: 2025-07-02 06:08:10, status changed: 2025-07-02 17:40:31

Project settings

Protein sequence(s)	GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWMIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM input pdb
Peptide sequence	VLMAFTLCF
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	172.065	0.552118	1.52385	95
cluster_2.pdb ( medoid)	65.5029	1.51138	7.48968	99
cluster_3.pdb ( medoid)	40.3014	2.63018	23.8413	106
cluster_4.pdb ( medoid)	35.3714	1.83764	4.55226	65
cluster_5.pdb ( medoid)	31.6767	3.15689	11.1433	100
cluster_6.pdb ( medoid)	28.363	1.51606	5.42993	43
cluster_7.pdb ( medoid)	22.0563	3.30971	15.919	73
cluster_8.pdb ( medoid)	16.0386	9.91361	38.8175	159
cluster_9.pdb ( medoid)	12.1744	8.8711	32.3565	108
cluster_10.pdb ( medoid)	11.9896	12.6776	41.9623	152