Project name: TVTEDKINA_ıl6

Status: done

submitted: 2025-03-09 19:16:52, status changed: 2025-03-09 22:51:09

Project settings
Protein sequence(s) MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM input pdb
Peptide sequence TVTEDKINA
Simulation mc cycles50
Peptide secondary structure psipred CCCHHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.3646 3.55678 18.8181 108
cluster_2.pdb ( medoid) 24.414 7.16801 27.6604 175
cluster_3.pdb ( medoid) 15.8386 9.15487 32.1116 145
cluster_4.pdb ( medoid) 14.8961 7.58589 33.3796 113
cluster_5.pdb ( medoid) 8.46439 13.4682 30.731 114
cluster_6.pdb ( medoid) 7.99076 9.63612 32.132 77
cluster_7.pdb ( medoid) 7.55276 10.5922 30.6743 80
cluster_8.pdb ( medoid) 6.3909 12.9872 29.6919 83
cluster_9.pdb ( medoid) 6.09095 11.8208 30.7497 72
cluster_10.pdb ( medoid) 2.54012 12.9915 29.5805 33