Project name: 3e47e25a30d4123

Status: done

submitted: 2026-07-16 14:02:47, status changed: 2026-07-16 19:41:05

Project settings
Protein sequence(s) PYLQILEQPKQRGFRFRYVAEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPE input pdb
Peptide sequence VLGYMQLR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.2014 3.97241 21.6904 116
cluster_2.pdb ( medoid) 23.4745 5.19713 23.8442 122
cluster_3.pdb ( medoid) 16.2876 9.70063 25.9657 158
cluster_4.pdb ( medoid) 14.0926 7.45072 38.3942 105
cluster_5.pdb ( medoid) 12.5603 9.15583 31.268 115
cluster_6.pdb ( medoid) 10.5146 11.6029 31.5732 122
cluster_7.pdb ( medoid) 9.00068 10.3326 33.945 93
cluster_8.pdb ( medoid) 6.15651 12.3447 39.4014 76
cluster_9.pdb ( medoid) 3.68878 11.1148 21.949 41
cluster_10.pdb ( medoid) 2.59203 20.0615 43.6551 52