Project name: 9ASF_QAIELQ_E2

Status: done

submitted: 2026-05-30 16:24:04, status changed: 2026-05-31 10:15:53

Project settings
Protein sequence(s) GSSHSMRYFFTSVSRPGRGEPRFIAVVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSSQQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW input pdb
Peptide sequence QAIELQLTLETIYNSQYSN
Simulation mc cycles200
Peptide secondary structure psipred CCEEEEEEHHHHHHCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.4013 5.12325 16.6879 166
cluster_2.pdb ( medoid) 27.751 7.20694 29.2763 200
cluster_3.pdb ( medoid) 23.0743 6.97745 22.1084 161
cluster_4.pdb ( medoid) 14.6573 9.61979 29.9451 141
cluster_5.pdb ( medoid) 14.5492 5.56731 13.1479 81
cluster_6.pdb ( medoid) 9.51088 7.99085 18.7504 76
cluster_7.pdb ( medoid) 9.45812 8.24688 16.8963 78
cluster_8.pdb ( medoid) 5.23042 9.55946 19.26 50
cluster_9.pdb ( medoid) 2.9837 11.7304 32.8981 35
cluster_10.pdb ( medoid) 1.24468 9.64103 26.0815 12