Project name: REHAB-DM

Status: done

submitted: 2026-06-03 13:40:04, status changed: 2026-06-03 23:52:21

Project settings
Protein sequence(s) VAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF input pdb
Peptide sequence FKCRRWQWRMKKLGAPSITCVRRAF
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHHHHHHHCCCCEEEEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 65.6585 1.52303 4.63552 100
cluster_2.pdb ( medoid) 23.5259 5.01574 23.8979 118
cluster_3.pdb ( medoid) 15.8017 6.77141 29.1308 107
cluster_4.pdb ( medoid) 13.599 8.30943 48.2065 113
cluster_5.pdb ( medoid) 10.7722 5.75558 16.6047 62
cluster_6.pdb ( medoid) 8.98648 12.3519 39.4278 111
cluster_7.pdb ( medoid) 7.86337 12.8444 33.8818 101
cluster_8.pdb ( medoid) 7.74482 11.1042 30.8944 86
cluster_9.pdb ( medoid) 7.6877 19.5117 51.9731 150
cluster_10.pdb ( medoid) 6.52859 7.96497 24.4061 52