CABS-dock: 3f0c6be643e1f6f

Project name: 3f0c6be643e1f6f

Status: done

submitted: 2025-12-23 15:34:51, status changed: 2025-12-23 18:15:07

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RVIFVQCGSNCFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.2562	6.69477	32.225	149
cluster_2.pdb ( medoid)	18.959	7.01514	29.5928	133
cluster_3.pdb ( medoid)	14.4537	12.0384	48.6581	174
cluster_4.pdb ( medoid)	9.27923	10.2379	37.6503	95
cluster_5.pdb ( medoid)	6.93596	14.2734	34.1824	99
cluster_6.pdb ( medoid)	6.82893	9.22545	26.0038	63
cluster_7.pdb ( medoid)	6.46187	16.2492	46.8707	105
cluster_8.pdb ( medoid)	5.00278	15.3915	49.6543	77
cluster_9.pdb ( medoid)	4.70694	9.98526	21.7496	47
cluster_10.pdb ( medoid)	3.10344	18.689	45.1045	58