Project name: braf_monomer_peptide_11

Status: done

submitted: 2025-12-28 10:33:02, status changed: 2025-12-28 17:40:47

Project settings
Protein sequence(s) DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYKHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRRDLKSNNIFLHEDNNTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAEECLKKKRDERPSFPRILAEIEELARE input pdb
Peptide sequence VLRKTRHVNILLFMG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCEEEEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 38.0259 2.55089 43.5752 97
cluster_2.pdb ( medoid) 23.5392 6.58475 14.8739 155
cluster_3.pdb ( medoid) 17.5937 8.86683 20.2903 156
cluster_4.pdb ( medoid) 16.6872 4.5544 21.3509 76
cluster_5.pdb ( medoid) 11.3144 8.83831 43.0225 100
cluster_6.pdb ( medoid) 9.46646 8.45089 39.4099 80
cluster_7.pdb ( medoid) 7.6727 15.5095 45.2457 119
cluster_8.pdb ( medoid) 4.58657 14.8259 32.1311 68
cluster_9.pdb ( medoid) 4.50616 15.3124 41.4632 69
cluster_10.pdb ( medoid) 4.41667 18.1132 46.6295 80