Project name: 3f50199643c2f05

Status: done

submitted: 2026-04-11 14:33:16, status changed: 2026-04-11 16:13:57

Project settings
Protein sequence(s) MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence RRRVQPYGSNDARRH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.9923 7.04585 17.7937 162
cluster_2.pdb ( medoid) 21.4193 7.5166 27.4071 161
cluster_3.pdb ( medoid) 20.4905 6.10039 14.8856 125
cluster_4.pdb ( medoid) 18.0055 6.22032 21.8736 112
cluster_5.pdb ( medoid) 16.669 5.99916 16.7724 100
cluster_6.pdb ( medoid) 15.906 8.17303 24.5302 130
cluster_7.pdb ( medoid) 7.2333 7.18897 25.5423 52
cluster_8.pdb ( medoid) 6.62492 11.019 19.1193 73
cluster_9.pdb ( medoid) 5.24843 10.4793 19.871 55
cluster_10.pdb ( medoid) 3.92885 7.63582 19.8675 30