Project name: Sc1QL17_LexA

Status: done

submitted: 2025-11-13 13:58:46, status changed: 2025-11-13 16:14:23

Project settings
Protein sequence(s) EEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL input pdb
Peptide sequence KVAQHIAQKVIHGLKNE
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 133.564 0.771165 16.4453 103
cluster_2.pdb ( medoid) 21.8145 4.90499 26.1042 107
cluster_3.pdb ( medoid) 18.6775 6.42483 34.4148 120
cluster_4.pdb ( medoid) 13.4882 8.526 28.2525 115
cluster_5.pdb ( medoid) 11.9461 8.87319 26.3848 106
cluster_6.pdb ( medoid) 11.1528 10.5803 22.7603 118
cluster_7.pdb ( medoid) 9.80617 8.36209 25.7265 82
cluster_8.pdb ( medoid) 8.90714 15.0441 32.95 134
cluster_9.pdb ( medoid) 5.77218 12.8201 27.0001 74
cluster_10.pdb ( medoid) 2.52948 16.2088 32.2318 41