Project name: 40120ad3f569029

Status: done

submitted: 2025-08-25 21:16:42, status changed: 2025-08-26 00:27:39

Project settings
Protein sequence(s) SGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTIKP input pdb
Peptide sequence NDIEYNAPREIKNHGARQLY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCHHHHHCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.5065 11.0199 30.1954 237
cluster_2.pdb ( medoid) 18.092 7.84877 29.9516 142
cluster_3.pdb ( medoid) 10.2361 8.30396 29.5128 85
cluster_4.pdb ( medoid) 10.0163 5.19153 18.5226 52
cluster_5.pdb ( medoid) 8.99137 8.1189 26.1648 73
cluster_6.pdb ( medoid) 8.60319 16.738 40.1455 144
cluster_7.pdb ( medoid) 6.31244 13.6239 28.6787 86
cluster_8.pdb ( medoid) 5.04798 13.6688 36.0447 69
cluster_9.pdb ( medoid) 4.16155 16.34 35.2658 68
cluster_10.pdb ( medoid) 3.39394 12.9643 35.0576 44