Project name: 402360130c0ca8d

Status: done

submitted: 2025-08-25 12:29:54, status changed: 2025-08-25 16:12:05

Project settings
Protein sequence(s) KGEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLSLKFICTTGKLPVPWPTLVTTLTTTVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIYFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVEDGSVQLADHYQQNTPIGDGPVLDHYLSTQTILSKDLNE input pdb
Peptide sequence RDHMVLHEYVNAAGIT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCHHHHHHHCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 16.926 7.73955 23.6052 131
cluster_2.pdb ( medoid) 16.9055 6.74338 27.9935 114
cluster_3.pdb ( medoid) 15.7492 7.93693 21.8563 125
cluster_4.pdb ( medoid) 10.3474 12.4669 34.043 129
cluster_5.pdb ( medoid) 8.89362 13.8301 30.7344 123
cluster_6.pdb ( medoid) 8.32029 13.8216 36.5993 115
cluster_7.pdb ( medoid) 7.60434 9.59978 19.9523 73
cluster_8.pdb ( medoid) 4.75074 10.7352 37.0141 51
cluster_9.pdb ( medoid) 3.54922 18.3139 41.8644 65
cluster_10.pdb ( medoid) 3.40153 21.7549 42.5061 74