CABS-dock: 402360130c0ca8d

Project name: 402360130c0ca8d

Status: done

submitted: 2025-08-25 12:29:54, status changed: 2025-08-25 16:12:05

Project settings

Protein sequence(s)	KGEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLSLKFICTTGKLPVPWPTLVTTLTTTVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIYFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVEDGSVQLADHYQQNTPIGDGPVLDHYLSTQTILSKDLNE input pdb
Peptide sequence	RDHMVLHEYVNAAGIT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCHHHHHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	16.926	7.73955	23.6052	131
cluster_2.pdb ( medoid)	16.9055	6.74338	27.9935	114
cluster_3.pdb ( medoid)	15.7492	7.93693	21.8563	125
cluster_4.pdb ( medoid)	10.3474	12.4669	34.043	129
cluster_5.pdb ( medoid)	8.89362	13.8301	30.7344	123
cluster_6.pdb ( medoid)	8.32029	13.8216	36.5993	115
cluster_7.pdb ( medoid)	7.60434	9.59978	19.9523	73
cluster_8.pdb ( medoid)	4.75074	10.7352	37.0141	51
cluster_9.pdb ( medoid)	3.54922	18.3139	41.8644	65
cluster_10.pdb ( medoid)	3.40153	21.7549	42.5061	74