CABS-dock: 40b5dfb2a219ad5

Project name: 40b5dfb2a219ad5

Status: done

submitted: 2026-02-27 02:50:08, status changed: 2026-02-27 05:36:27

Project settings

Protein sequence(s)	QQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIH input pdb
Peptide sequence	EMFGTSSET
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	64.6985	1.8393	4.85333	119
cluster_2.pdb ( medoid)	54.8144	3.70341	24.4036	203
cluster_3.pdb ( medoid)	33.0259	4.51161	25.2623	149
cluster_4.pdb ( medoid)	24.1866	2.1913	23.9971	53
cluster_5.pdb ( medoid)	17.4285	4.30331	34.2968	75
cluster_6.pdb ( medoid)	16.9371	4.01487	19.7832	68
cluster_7.pdb ( medoid)	12.1317	7.58344	28.6537	92
cluster_8.pdb ( medoid)	10.1028	7.72065	34.7114	78
cluster_9.pdb ( medoid)	6.83552	15.6535	38.899	107
cluster_10.pdb ( medoid)	4.2742	13.1019	31.1916	56