CABS-dock: 4113c4d53dc52e8

Project name: 4113c4d53dc52e8

Status: done

submitted: 2026-05-01 11:22:23, status changed: 2026-05-01 17:29:43

Project settings

Protein sequence(s)	QTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVK input pdb
Peptide sequence	RIIDLLWRVRRPQKPKFVTVWVR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHHCCCCCCCCEEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.1699	3.56532	18.9083	104
cluster_2.pdb ( medoid)	17.1192	6.25028	29.6705	107
cluster_3.pdb ( medoid)	15.5366	11.4568	33.8331	178
cluster_4.pdb ( medoid)	13.6062	13.6703	34.1493	186
cluster_5.pdb ( medoid)	10.8597	9.66875	28.9007	105
cluster_6.pdb ( medoid)	7.14713	10.4937	34.7518	75
cluster_7.pdb ( medoid)	6.14385	9.92862	31.2386	61
cluster_8.pdb ( medoid)	5.90746	9.8181	38.229	58
cluster_9.pdb ( medoid)	5.43413	14.3537	29.5223	78
cluster_10.pdb ( medoid)	5.11827	9.37818	23.8023	48