CABS-dock: 421c5653df568d0

Project name: 421c5653df568d0

Status: done

submitted: 2026-07-08 09:37:35, status changed: 2026-07-08 13:24:21

Project settings

Protein sequence(s)	GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence	FTDVQSTPGTHIANE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.6218	4.05477	30.7447	112
cluster_2.pdb ( medoid)	23.6505	4.94703	20.2402	117
cluster_3.pdb ( medoid)	20.5689	6.27162	29.1192	129
cluster_4.pdb ( medoid)	17.7305	6.54241	21.6428	116
cluster_5.pdb ( medoid)	15.3573	6.77201	18.9175	104
cluster_6.pdb ( medoid)	11.9349	12.233	25.1915	146
cluster_7.pdb ( medoid)	9.27401	7.76364	15.1392	72
cluster_8.pdb ( medoid)	7.46727	13.1239	34.5453	98
cluster_9.pdb ( medoid)	6.05236	10.0787	21.602	61
cluster_10.pdb ( medoid)	3.84722	11.6968	23.7252	45