Project name: 2iv9

Status: done

submitted: 2026-02-13 14:26:36, status changed: 2026-02-14 11:23:10

Project settings
Protein sequence(s) MAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKNSFGDGFADFGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN input pdb
Peptide sequence GILGFVFTL
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.1786 4.6304 20.9008 149
cluster_2.pdb ( medoid) 30.9153 3.6228 22.5521 112
cluster_3.pdb ( medoid) 25.2634 4.27497 34.4742 108
cluster_4.pdb ( medoid) 20.4545 6.2089 37.8379 127
cluster_5.pdb ( medoid) 16.701 11.4963 37.2628 192
cluster_6.pdb ( medoid) 9.95491 12.4562 34.3902 124
cluster_7.pdb ( medoid) 7.67848 11.0699 29.8658 85
cluster_8.pdb ( medoid) 5.33354 6.18726 12.0026 33
cluster_9.pdb ( medoid) 3.26642 11.9397 27.6002 39
cluster_10.pdb ( medoid) 3.12061 9.93395 21.1244 31